Human PLA2G10(Phospholipase A2, Group X) ELISA Kit

Human PLA2G10(Phospholipase A2, Group X) ELISA Kit

To Order: Contact us

Human Phospholipase A2, Group X (PLA2G10) ELISA Kit
RDR-PLA2G10-Hu-96Tests	Reddot Biotech	96 Tests	EUR 756

Human Phospholipase A2, Group X (PLA2G10) ELISA Kit
RD-PLA2G10-Hu-48Tests	Reddot Biotech	48 Tests	EUR 521

Human Phospholipase A2, Group X (PLA2G10) ELISA Kit
RD-PLA2G10-Hu-96Tests	Reddot Biotech	96 Tests	EUR 723

Human Phospholipase A2, Group X (PLA2G10)ELISA kit
201-12-2526	SunredBio	96 tests	EUR 440
This Phospholipase A2 ELISA kit is validated to work with samples from whole blood, serum, plasma and cell culture supernatant.
Description: A quantitative ELISA kit for measuring Human in samples from biological fluids.

Human Phospholipase A2, Group X (PLA2G10) ELISA Kit
20-abx152758	Abbexa	EUR 7378.00 EUR 3933.00 EUR 911.00	10 × 96 tests 5 × 96 tests 96 tests
Shipped within 5-7 working days.

Human Phospholipase A2, Group X (PLA2G10) ELISA Kit
abx252990-96tests	Abbexa	96 tests	EUR 668
Shipped within 5-12 working days.

Human PLA2G10(Phospholipase A2, Group X) ELISA Kit
EH3603	FN Test	96T	EUR 524.1
Detection range: 7.813-500 pg/ml Uniprot ID: O15496 Alias: PLA2G10
Description: Method of detection: Double Antibody, Sandwich ELISA;Reacts with: Homo sapiens;Sensitivity: 4.688pg/ml

Human Phospholipase A2, Group X(PLA2G10)ELISA Kit
QY-E05176	Qayee Biotechnology	96T	EUR 361

Human Phospholipase A2, Group X (PLA2G10) ELISA Kit
SED833Hu-10x96wellstestplate	Cloud-Clone	10x96-wells test plate	EUR 4731.5
The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Phospholipase A2, Group X (PLA2G10) were tested on 3 different plates, 8 replicates in each plate CV(%) = SD/meanX100 Intra-Assay: CV<10% Inter-Assay: Show more
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group X (PLA2G10) in serum, plasma and other biological fluids.

Human Phospholipase A2, Group X (PLA2G10) ELISA Kit
SED833Hu-1x48wellstestplate	Cloud-Clone	1x48-wells test plate	EUR 477.3
The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Phospholipase A2, Group X (PLA2G10) were tested on 3 different plates, 8 replicates in each plate CV(%) = SD/meanX100 Intra-Assay: CV<10% Inter-Assay: Show more
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group X (PLA2G10) in serum, plasma and other biological fluids.

Human Phospholipase A2, Group X (PLA2G10) ELISA Kit
SED833Hu-1x96wellstestplate	Cloud-Clone	1x96-wells test plate	EUR 639
The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Phospholipase A2, Group X (PLA2G10) were tested on 3 different plates, 8 replicates in each plate CV(%) = SD/meanX100 Intra-Assay: CV<10% Inter-Assay: Show more
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group X (PLA2G10) in serum, plasma and other biological fluids.

Human Phospholipase A2, Group X (PLA2G10) ELISA Kit
SED833Hu-5x96wellstestplate	Cloud-Clone	5x96-wells test plate	EUR 2575.5
The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Phospholipase A2, Group X (PLA2G10) were tested on 3 different plates, 8 replicates in each plate CV(%) = SD/meanX100 Intra-Assay: CV<10% Inter-Assay: Show more
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group X (PLA2G10) in serum, plasma and other biological fluids.

Human Phospholipase A2, Group X (PLA2G10) ELISA Kit
4-SED833Hu	Cloud-Clone	EUR 4782.00 EUR 2526.00 EUR 640.00	10 plates of 96 wells 5 plates of 96 wells 1 plate of 96 wells
Known also as Phospholipase A2, Group X elisa. Alternative names of the recognized antigen: GXPLA2 GX sPLA2 sPLA2-X Group 10 secretory phospholipase A2 Phosphatidylcholine 2-acylhydrolase 10
Description: Enzyme-linked immunosorbent assay based on the Double-antibody Sandwich method for detection of Human Phospholipase A2, Group X (PLA2G10) in samples from Serum, plasma and other biological fluids with no significant corss-reactivity with analogues from other species.

Phospholipase A2, Group X (PLA2G10) Antibody
20-abx126373	Abbexa	EUR 411.00 EUR 592.00 EUR 182.00 EUR 314.00	100 ul 200 ul 20 ul 50 ul
Shipped within 5-10 working days.

Phospholipase A2, Group X (PLA2G10) Antibody
20-abx128169	Abbexa	EUR 425.00 EUR 133.00 EUR 1205.00 EUR 578.00 EUR 328.00	100 ug 10 ug 1 mg 200 ug 50 ug
Shipped within 5-7 working days.

Phospholipase A2, Group X (PLA2G10) Antibody
20-abx174048	Abbexa	EUR 857.00 EUR 439.00	1 mg 200 ug
Please enquire.

Phospholipase A2, Group X (PLA2G10) Antibody
20-abx301835	Abbexa	EUR 411.00 EUR 1845.00 EUR 599.00 EUR 182.00 EUR 300.00	100 ug 1 mg 200 ug 20 ug 50 ug
Shipped within 5-10 working days.

Recombinant Phospholipase A2, Group X (PLA2G10)
4-RPD833Hu01	Cloud-Clone	EUR 501.41 EUR 237.00 EUR 1605.28 EUR 601.76 EUR 1103.52 EUR 398.00 EUR 3863.20	100 ug 10ug 1 mg 200 ug 500 ug 50ug 5 mg
Uniprot ID: O15496 Buffer composition: PBS, pH 7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300. Form: Freeze-dried powder Predicted Molecular Mass (KD): 18.7KDa Isoelectric Point: Inquire
Description: Recombinant Human Phospholipase A2, Group X expressed in: E.coli

Human Phospholipase A2, Group X (PLA2G10) Protein
20-abx167064	Abbexa	EUR 704.00 EUR 286.00 EUR 2165.00 EUR 829.00 EUR 495.00	100 ug 10 ug 1 mg 200 ug 50 ug
Shipped within 5-7 working days.

Monkey Phospholipase A2, Group X (PLA2G10) ELISA Kit
abx360270-96tests	Abbexa	96 tests	EUR 825
Shipped within 5-12 working days.

Pig Phospholipase A2, Group X (PLA2G10) ELISA Kit
abx362012-96tests	Abbexa	96 tests	EUR 825
Shipped within 5-12 working days.

Rabbit Phospholipase A2, Group X (PLA2G10) ELISA Kit
abx362347-96tests	Abbexa	96 tests	EUR 825
Shipped within 5-12 working days.

Chicken Phospholipase A2, Group X (PLA2G10) ELISA Kit
abx356098-96tests	Abbexa	96 tests	EUR 825
Shipped within 5-12 working days.

Human Phospholipase A2, Group X (PLA2G10) CLIA Kit
abx197460-96tests	Abbexa	96 tests	EUR 825
Shipped within 5-12 working days.

Human Phospholipase A2, Group X (PLA2G10) CLIA Kit
20-abx494408	Abbexa	EUR 7973.00 EUR 4246.00 EUR 981.00	10 × 96 tests 5 × 96 tests 96 tests
Please enquire.

ELISA kit for Human PLA2G10 (Phospholipase A2, Group X)
E-EL-H1011	Elabscience Biotech	1 plate of 96 wells	EUR 534
Gentaur's PLA2G10 ELISA kit utilizes the Sandwich-ELISA principle. The micro ELISA plate provided in this kit has been pre-coated with an antibody specific to Human PLA2G10. Standards or samples are added to the micro ELISA plate wells and combined w Show more
Description: A sandwich ELISA kit for quantitative measurement of Human PLA2G10 (Phospholipase A2, Group X) in samples from Serum, Plasma, Cell supernatant

ELISA kit for Human PLA2G10 (Phospholipase A2, Group X)
ELK4236	ELK Biotech	1 plate of 96 wells	EUR 432
The microtiter plate provided in this kit has been pre-coated with an antibody specific to Phospholipase A2, Group X (PLA2G10). Standards or samples are then added to the appropriate microtiter plate wells with a biotin-conjugated antibody specific t Show more
Description: A sandwich ELISA kit for detection of Phospholipase A2, Group X from Human in samples from blood, serum, plasma, cell culture fluid and other biological fluids.

Phospholipase A2, Group X (PLA2G10) Antibody (HRP)
20-abx315919	Abbexa	EUR 411.00 EUR 1845.00 EUR 599.00 EUR 182.00 EUR 300.00	100 ug 1 mg 200 ug 20 ug 50 ug
Shipped within 5-10 working days.

Phospholipase A2, Group X (PLA2G10) Antibody (FITC)
20-abx315920	Abbexa	EUR 411.00 EUR 1845.00 EUR 599.00 EUR 182.00 EUR 300.00	100 ug 1 mg 200 ug 20 ug 50 ug
Shipped within 5-10 working days.

Phospholipase A2, Group X (PLA2G10) Antibody (Biotin)
20-abx315921	Abbexa	EUR 411.00 EUR 1845.00 EUR 599.00 EUR 182.00 EUR 300.00	100 ug 1 mg 200 ug 20 ug 50 ug
Shipped within 5-10 working days.

Phospholipase A2, Group X (PLA2G10) Polyclonal Antibody (Human)
4-PAD833Hu01	Cloud-Clone	EUR 247.00 EUR 2510.00 EUR 625.00 EUR 310.00 EUR 214.00	100ul 10ml 1ml 200ul 20ul
Sequence of the immunogen: PLA2G10 (Glu32~Asp165) Buffer composition: PBS, pH7.4, containing 0.02% NaN3, 50% glycerol.
Description: A Rabbit polyclonal antibody against Human Phospholipase A2, Group X (PLA2G10)

CLIA kit for Human PLA2G10 (Phospholipase A2, Group X)
E-CL-H0681	Elabscience Biotech	1 plate of 96 wells	EUR 584
Gentaur's PLA2G10 CLIA kit utilizes the Sandwich- CLIA principle. The micro CLIA plate provided in this kit has been pre-coated with an antibody specific to Human PLA2G10 . Standards or samples are added to the micro CLIA plate wells and combined wit Show more
Description: A sandwich CLIA kit for quantitative measurement of Human PLA2G10 (Phospholipase A2, Group X) in samples from Serum, Plasma, Cell supernatant

Phospholipase A2, Group X (PLA2G10) Polyclonal Antibody (Human), APC
4-PAD833Hu01-APC	Cloud-Clone	EUR 345.00 EUR 3275.00 EUR 912.00 EUR 440.00 EUR 219.00	100ul 10ml 1ml 200ul 20ul
Sequence of the immunogen: PLA2G10 (Glu32~Asp165) Buffer composition: PBS, pH7.4, containing 0.02% NaN3, 50% glycerol.
Description: A Rabbit polyclonal antibody against Human Phospholipase A2, Group X (PLA2G10). This antibody is labeled with APC.

Phospholipase A2, Group X (PLA2G10) Polyclonal Antibody (Human), Biotinylated
4-PAD833Hu01-Biotin	Cloud-Clone	EUR 311.00 EUR 2460.00 EUR 727.00 EUR 381.00 EUR 219.00	100ul 10ml 1ml 200ul 20ul
Sequence of the immunogen: PLA2G10 (Glu32~Asp165) Buffer composition: PBS, pH7.4, containing 0.02% NaN3, 50% glycerol.
Description: A Rabbit polyclonal antibody against Human Phospholipase A2, Group X (PLA2G10). This antibody is labeled with Biotin.

Phospholipase A2, Group X (PLA2G10) Polyclonal Antibody (Human), Cy3
4-PAD833Hu01-Cy3	Cloud-Clone	EUR 419.00 EUR 4325.00 EUR 1175.00 EUR 545.00 EUR 251.00	100ul 10ml 1ml 200ul 20ul
Sequence of the immunogen: PLA2G10 (Glu32~Asp165) Buffer composition: PBS, pH7.4, containing 0.02% NaN3, 50% glycerol.
Description: A Rabbit polyclonal antibody against Human Phospholipase A2, Group X (PLA2G10). This antibody is labeled with Cy3.

Phospholipase A2, Group X (PLA2G10) Polyclonal Antibody (Human), FITC
4-PAD833Hu01-FITC	Cloud-Clone	EUR 296.00 EUR 2640.00 EUR 750.00 EUR 372.00 EUR 195.00	100ul 10ml 1ml 200ul 20ul
Sequence of the immunogen: PLA2G10 (Glu32~Asp165) Buffer composition: PBS, pH7.4, containing 0.02% NaN3, 50% glycerol.
Description: A Rabbit polyclonal antibody against Human Phospholipase A2, Group X (PLA2G10). This antibody is labeled with FITC.

Phospholipase A2, Group X (PLA2G10) Polyclonal Antibody (Human), HRP
4-PAD833Hu01-HRP	Cloud-Clone	EUR 316.00 EUR 2855.00 EUR 807.00 EUR 398.00 EUR 206.00	100ul 10ml 1ml 200ul 20ul
Sequence of the immunogen: PLA2G10 (Glu32~Asp165) Buffer composition: PBS, pH7.4, containing 0.02% NaN3, 50% glycerol.
Description: A Rabbit polyclonal antibody against Human Phospholipase A2, Group X (PLA2G10). This antibody is labeled with HRP.

Phospholipase A2, Group X (PLA2G10) Polyclonal Antibody (Human), PE
4-PAD833Hu01-PE	Cloud-Clone	EUR 296.00 EUR 2640.00 EUR 750.00 EUR 372.00 EUR 195.00	100ul 10ml 1ml 200ul 20ul
Sequence of the immunogen: PLA2G10 (Glu32~Asp165) Buffer composition: PBS, pH7.4, containing 0.02% NaN3, 50% glycerol.
Description: A Rabbit polyclonal antibody against Human Phospholipase A2, Group X (PLA2G10). This antibody is labeled with PE.

Phospholipase A2, Group X (PLA2G10) Polyclonal Antibody (Human), APC-Cy7
4-PAD833Hu01-APC-Cy7	Cloud-Clone	EUR 571.00 EUR 6430.00 EUR 1705.00 EUR 760.00 EUR 319.00	100ul 10ml 1ml 200ul 20ul
Sequence of the immunogen: PLA2G10 (Glu32~Asp165) Buffer composition: PBS, pH7.4, containing 0.02% NaN3, 50% glycerol.
Description: A Rabbit polyclonal antibody against Human Phospholipase A2, Group X (PLA2G10). This antibody is labeled with APC-Cy7.

Human Group 10 secretory phospholipase A2(PLA2G10) ELISA kit
CSB-EL018085HU-24T	Cusabio	1 plate of 24 wells	EUR 165
Sample volume: 50-100ul Detection wavelength: 450nm Assay performance time: 1 to 4 hours.
Description: Quantitativesandwich ELISA kit for measuring Human Group 10 secretory phospholipase A2 (PLA2G10) in samples from serum, plasma, cell culture supernates, tissue homogenates. A new trial version of the kit, which allows you to test the kit in your application at a reasonable price.

Human Group 10 secretory phospholipase A2(PLA2G10) ELISA kit
1-CSB-EL018085HU	Cusabio	EUR 804.00 EUR 5099.00 EUR 2704.00	1 plate of 96 wells 10 plates of 96 wells each 5 plates of 96 wells each
Sample volume: 50-100ul Detection wavelength: 450nm Assay performance time: 1 to 4 hours.
Description: Quantitativesandwich ELISA kit for measuring Human Group 10 secretory phospholipase A2(PLA2G10) in samples from serum, plasma, cell culture supernates, tissue homogenates. Now available in a cost efficient pack of 5 plates of 96 wells each, conveniently packed along with the other reagents in 5 separate kits.

Human Group 10 secretory phospholipase A2, PLA2G10 ELISA KIT
ELI-37033h	Lifescience Market	96 Tests	EUR 824

Mouse Group 10 secretory phospholipase A2(PLA2G10) ELISA kit
CSB-EL018085MO-24T	Cusabio	1 plate of 24 wells	EUR 165
Sample volume: 50-100ul Detection wavelength: 450nm Assay performance time: 1 to 4 hours.
Description: Quantitativesandwich ELISA kit for measuring Mouse Group 10 secretory phospholipase A2 (PLA2G10) in samples from serum, plasma, cell culture supernates, tissue homogenates. A new trial version of the kit, which allows you to test the kit in your application at a reasonable price.

Mouse Group 10 secretory phospholipase A2(PLA2G10) ELISA kit
1-CSB-EL018085MO	Cusabio	EUR 804.00 EUR 5099.00 EUR 2704.00	1 plate of 96 wells 10 plates of 96 wells each 5 plates of 96 wells each
Sample volume: 50-100ul Detection wavelength: 450nm Assay performance time: 1 to 4 hours.
Description: Quantitativesandwich ELISA kit for measuring Mouse Group 10 secretory phospholipase A2(PLA2G10) in samples from serum, plasma, cell culture supernates, tissue homogenates. Now available in a cost efficient pack of 5 plates of 96 wells each, conveniently packed along with the other reagents in 5 separate kits.

Rat Group 10 secretory phospholipase A2(PLA2G10) ELISA kit
CSB-EL018085RA-24T	Cusabio	1 plate of 24 wells	EUR 165
Sample volume: 50-100ul Detection wavelength: 450nm Assay performance time: 1 to 4 hours.
Description: Quantitativesandwich ELISA kit for measuring Rat Group 10 secretory phospholipase A2 (PLA2G10) in samples from serum, plasma, cell culture supernates, tissue homogenates. A new trial version of the kit, which allows you to test the kit in your application at a reasonable price.

Rat Group 10 secretory phospholipase A2(PLA2G10) ELISA kit
1-CSB-EL018085RA	Cusabio	EUR 804.00 EUR 5099.00 EUR 2704.00	1 plate of 96 wells 10 plates of 96 wells each 5 plates of 96 wells each
Sample volume: 50-100ul Detection wavelength: 450nm Assay performance time: 1 to 4 hours.
Description: Quantitativesandwich ELISA kit for measuring Rat Group 10 secretory phospholipase A2(PLA2G10) in samples from serum, plasma, cell culture supernates, tissue homogenates. Now available in a cost efficient pack of 5 plates of 96 wells each, conveniently packed along with the other reagents in 5 separate kits.

Mouse Group 10 secretory phospholipase A2, Pla2g10 ELISA KIT
ELI-16162m	Lifescience Market	96 Tests	EUR 865

PLA2G10 Secreted Phospholipase A2-X Human Recombinant Protein
PROTO15496	BosterBio	Regular: 10ug	EUR 317
Description: Secreted Phospholipase A2-X Human Recombinant is manufactured with N-terminal fusion HisTag. PLA2G10 His-Tagged Fusion Protein, is 15.5 kDa containing 123 amino acid residues of the human secreted phospholipase A2-X and 16 additional amino acid residues - HisTag (underlined).;MRGSHHHHHHGMASHMGILELAGTVGCVGPRTPIAYMKYGCFCGLGGHGQ;PRDAIDWCCHGHDCCYTRAEEAGCSPKTERYSWQCVNQSVLCGPAENKCQE;LLCKCDQEIANCLAQTEYNLKYLFYPQFLCEPDSPKCD.

ELISA kit for Rat Group 10 secretory phospholipase A2 (PLA2G10)
KTE100470-48T	Abbkine	48T	EUR 332
The A2 phospholipases (PLA2s EC 3.1.1.4) catalyze the release of fatty acids from phospholipids and play a role in a wide range of physiologic functions. Cupillard et al. (1997) cloned a novel secretory PLA2, termed GXSPLA2, from a human fetal lung Show more
Description: Quantitative sandwich ELISA for measuring Rat Group 10 secretory phospholipase A2 (PLA2G10) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

ELISA kit for Rat Group 10 secretory phospholipase A2 (PLA2G10)
KTE100470-5platesof96wells	Abbkine	5 plates of 96 wells	EUR 2115
The A2 phospholipases (PLA2s EC 3.1.1.4) catalyze the release of fatty acids from phospholipids and play a role in a wide range of physiologic functions. Cupillard et al. (1997) cloned a novel secretory PLA2, termed GXSPLA2, from a human fetal lung Show more
Description: Quantitative sandwich ELISA for measuring Rat Group 10 secretory phospholipase A2 (PLA2G10) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

ELISA kit for Rat Group 10 secretory phospholipase A2 (PLA2G10)
KTE100470-96T	Abbkine	96T	EUR 539
The A2 phospholipases (PLA2s EC 3.1.1.4) catalyze the release of fatty acids from phospholipids and play a role in a wide range of physiologic functions. Cupillard et al. (1997) cloned a novel secretory PLA2, termed GXSPLA2, from a human fetal lung Show more
Description: Quantitative sandwich ELISA for measuring Rat Group 10 secretory phospholipase A2 (PLA2G10) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

Human Phospholipase A2, Group IID (PLA2G2D)ELISA kit
201-12-2525	SunredBio	96 tests	EUR 440
This Phospholipase A2 ELISA kit is validated to work with samples from whole blood, serum, plasma and cell culture supernatant.
Description: A quantitative ELISA kit for measuring Human in samples from biological fluids.

Human Phospholipase A2, Group IIA (PLA2G2A)ELISA kit
201-12-2527	SunredBio	96 tests	EUR 440
This Phospholipase A2 ELISA kit is validated to work with samples from whole blood, serum, plasma and cell culture supernatant.
Description: A quantitative ELISA kit for measuring Human in samples from biological fluids.

Human Phospholipase A2, Group IVD (PLA2G4D)ELISA kit
201-12-2529	SunredBio	96 tests	EUR 440
This Phospholipase A2 ELISA kit is validated to work with samples from whole blood, serum, plasma and cell culture supernatant.
Description: A quantitative ELISA kit for measuring Human in samples from biological fluids.

Human Phospholipase A2, Group XIIB (PLA2G12B)ELISA kit
201-12-2530	SunredBio	96 tests	EUR 440
This Phospholipase A2 ELISA kit is validated to work with samples from whole blood, serum, plasma and cell culture supernatant.
Description: A quantitative ELISA kit for measuring Human in samples from biological fluids.

Human Phospholipase A2, Group XIIB (PLA2G12B) ELISA Kit
DLR-PLA2G12B-Hu-48T	DL Develop	48T	EUR 554
Should the Human Phospholipase A2, Group XIIB (PLA2G12B) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A sandwich quantitative ELISA assay kit for detection of Human Phospholipase A2, Group XIIB (PLA2G12B) in samples from serum, plasma, tissue homogenates or other biological fluids.

Human Phospholipase A2, Group XIIB (PLA2G12B) ELISA Kit
DLR-PLA2G12B-Hu-96T	DL Develop	96T	EUR 725
Should the Human Phospholipase A2, Group XIIB (PLA2G12B) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A sandwich quantitative ELISA assay kit for detection of Human Phospholipase A2, Group XIIB (PLA2G12B) in samples from serum, plasma, tissue homogenates or other biological fluids.

Human Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit
DLR-PLA2G2A-Hu-48T	DL Develop	48T	EUR 517
Should the Human Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A sandwich quantitative ELISA assay kit for detection of Human Phospholipase A2, Group IIA (PLA2G2A) in samples from serum, plasma, tissue homogenates or other biological fluids.

Human Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit
DLR-PLA2G2A-Hu-96T	DL Develop	96T	EUR 673
Should the Human Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A sandwich quantitative ELISA assay kit for detection of Human Phospholipase A2, Group IIA (PLA2G2A) in samples from serum, plasma, tissue homogenates or other biological fluids.

Human Phospholipase A2, Group IID (PLA2G2D) ELISA Kit
DLR-PLA2G2D-Hu-48T	DL Develop	48T	EUR 498
Should the Human Phospholipase A2, Group IID (PLA2G2D) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A sandwich quantitative ELISA assay kit for detection of Human Phospholipase A2, Group IID (PLA2G2D) in samples from serum, plasma, tissue homogenates or other biological fluids.

Human Phospholipase A2, Group IID (PLA2G2D) ELISA Kit
DLR-PLA2G2D-Hu-96T	DL Develop	96T	EUR 647
Should the Human Phospholipase A2, Group IID (PLA2G2D) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A sandwich quantitative ELISA assay kit for detection of Human Phospholipase A2, Group IID (PLA2G2D) in samples from serum, plasma, tissue homogenates or other biological fluids.

Human Phospholipase A2, Group III (PLA2G3) ELISA Kit
DLR-PLA2G3-Hu-48T	DL Develop	48T	EUR 517
Should the Human Phospholipase A2, Group III (PLA2G3) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A sandwich quantitative ELISA assay kit for detection of Human Phospholipase A2, Group III (PLA2G3) in samples from serum, plasma or other biological fluids.

Human Phospholipase A2, Group III (PLA2G3) ELISA Kit
DLR-PLA2G3-Hu-96T	DL Develop	96T	EUR 673
Should the Human Phospholipase A2, Group III (PLA2G3) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A sandwich quantitative ELISA assay kit for detection of Human Phospholipase A2, Group III (PLA2G3) in samples from serum, plasma or other biological fluids.

Human Phospholipase A2, Group IVD (PLA2G4D) ELISA Kit
DLR-PLA2G4D-Hu-48T	DL Develop	48T	EUR 554
Should the Human Phospholipase A2, Group IVD (PLA2G4D) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A sandwich quantitative ELISA assay kit for detection of Human Phospholipase A2, Group IVD (PLA2G4D) in samples from tissue homogenates or other biological fluids.

Human Phospholipase A2, Group IVD (PLA2G4D) ELISA Kit
DLR-PLA2G4D-Hu-96T	DL Develop	96T	EUR 725
Should the Human Phospholipase A2, Group IVD (PLA2G4D) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A sandwich quantitative ELISA assay kit for detection of Human Phospholipase A2, Group IVD (PLA2G4D) in samples from tissue homogenates or other biological fluids.

Human Phospholipase A2, Group V (PLA2G5) ELISA Kit
DLR-PLA2G5-Hu-48T	DL Develop	48T	EUR 517
Should the Human Phospholipase A2, Group V (PLA2G5) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A sandwich quantitative ELISA assay kit for detection of Human Phospholipase A2, Group V (PLA2G5) in samples from serum, plasma, tissue homogenates or other biological fluids.

Human Phospholipase A2, Group V (PLA2G5) ELISA Kit
DLR-PLA2G5-Hu-96T	DL Develop	96T	EUR 673
Should the Human Phospholipase A2, Group V (PLA2G5) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A sandwich quantitative ELISA assay kit for detection of Human Phospholipase A2, Group V (PLA2G5) in samples from serum, plasma, tissue homogenates or other biological fluids.

Human Phospholipase A2, Group XIIB (PLA2G12B) ELISA Kit
20-abx152759	Abbexa	EUR 7378.00 EUR 3933.00 EUR 911.00	10 × 96 tests 5 × 96 tests 96 tests
Shipped within 5-7 working days.

Human Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit
20-abx152760	Abbexa	EUR 7378.00 EUR 3933.00 EUR 911.00	10 × 96 tests 5 × 96 tests 96 tests
Shipped within 5-7 working days.

Human Phospholipase A2, Group IID (PLA2G2D) ELISA Kit
20-abx152761	Abbexa	EUR 7112.00 EUR 3792.00 EUR 879.00	10 × 96 tests 5 × 96 tests 96 tests
Shipped within 5-7 working days.

Human Phospholipase A2, Group IVD (PLA2G4D) ELISA Kit
20-abx152762	Abbexa	EUR 7378.00 EUR 3933.00 EUR 911.00	10 × 96 tests 5 × 96 tests 96 tests
Shipped within 5-7 working days.

Human Phospholipase A2, Group V (PLA2G5) ELISA Kit
20-abx152763	Abbexa	EUR 7378.00 EUR 3933.00 EUR 911.00	10 × 96 tests 5 × 96 tests 96 tests
Shipped within 5-7 working days.

Human Phospholipase A2 Group VI (PLA2G6) ELISA Kit
abx253845-96tests	Abbexa	96 tests	EUR 668
Shipped within 5-12 working days.

Human Group XV phospholipase A2, PLA2G15 ELISA KIT
ELI-21820h	Lifescience Market	96 Tests	EUR 824

Human Group XVI phospholipase A2, PLA2G16 ELISA KIT
ELI-45167h	Lifescience Market	96 Tests	EUR 824

Human Group IIA phospholipase A2 (PLA2G2A) ELISA Kit
abx575929-96tests	Abbexa	96 tests	EUR 739
Shipped within 5-12 working days.

Human Phospholipase A2, Group XIIB(PLA2G12B)ELISA Kit
QY-E05175	Qayee Biotechnology	96T	EUR 361

Human Phospholipase A2, Group IVD(PLA2G4D)ELISA Kit
QY-E05205	Qayee Biotechnology	96T	EUR 361

Human Phospholipase A2, Group IID(PLA2G2D)ELISA Kit
QY-E05226	Qayee Biotechnology	96T	EUR 361

Human Phospholipase A2, Group IIA(PLA2G2A)ELISA Kit
QY-E05227	Qayee Biotechnology	96T	EUR 361

Human Phospholipase A2, Group IIA ELISA Kit (PLA2G2A)
RK02095	Abclonal	96 Tests	EUR 521

Human PLA2G10(Phospholipase A2, Group X) ELISA Kit