Human PLA2G10(Phospholipase A2, Group X) ELISA Kit

Human PLA2G10(Phospholipase A2, Group X) ELISA Kit

To Order: Contact us

Human Phospholipase A2, Group X (PLA2G10) ELISA Kit

RDR-PLA2G10-Hu-96Tests 96 Tests
EUR 756

Human Phospholipase A2, Group X (PLA2G10) ELISA Kit

RD-PLA2G10-Hu-48Tests 48 Tests
EUR 521

Human Phospholipase A2, Group X (PLA2G10) ELISA Kit

RD-PLA2G10-Hu-96Tests 96 Tests
EUR 723

Human Phospholipase A2, Group X (PLA2G10)ELISA kit

201-12-2526 96 tests
EUR 440
  • This Phospholipase A2 ELISA kit is validated to work with samples from whole blood, serum, plasma and cell culture supernatant.
Description: A quantitative ELISA kit for measuring Human in samples from biological fluids.

Human Phospholipase A2, Group X (PLA2G10) ELISA Kit

20-abx152758
  • EUR 7378.00
  • EUR 3933.00
  • EUR 911.00
  • 10 × 96 tests
  • 5 × 96 tests
  • 96 tests
  • Shipped within 5-7 working days.

Human Phospholipase A2, Group X (PLA2G10) ELISA Kit

abx252990-96tests 96 tests
EUR 668
  • Shipped within 5-12 working days.

Human PLA2G10(Phospholipase A2, Group X) ELISA Kit

EH3603 96T
EUR 524.1
  • Detection range: 7.813-500 pg/ml
  • Uniprot ID: O15496
  • Alias: PLA2G10
Description: Method of detection: Double Antibody, Sandwich ELISA;Reacts with: Homo sapiens;Sensitivity: 4.688pg/ml

Human Phospholipase A2, Group X(PLA2G10)ELISA Kit

QY-E05176 96T
EUR 361

Human Phospholipase A2, Group X (PLA2G10) ELISA Kit

SED833Hu-10x96wellstestplate 10x96-wells test plate
EUR 4731.5
  • The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Phospholipase A2, Group X (PLA2G10) were tested on 3 different plates, 8 replicates in each plate
  • CV(%) = SD/meanX100
  • Intra-Assay: CV<10%
  • Inter-Assay:
  • Show more
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group X (PLA2G10) in serum, plasma and other biological fluids.

Human Phospholipase A2, Group X (PLA2G10) ELISA Kit

SED833Hu-1x48wellstestplate 1x48-wells test plate
EUR 477.3
  • The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Phospholipase A2, Group X (PLA2G10) were tested on 3 different plates, 8 replicates in each plate
  • CV(%) = SD/meanX100
  • Intra-Assay: CV<10%
  • Inter-Assay:
  • Show more
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group X (PLA2G10) in serum, plasma and other biological fluids.

Human Phospholipase A2, Group X (PLA2G10) ELISA Kit

SED833Hu-1x96wellstestplate 1x96-wells test plate
EUR 639
  • The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Phospholipase A2, Group X (PLA2G10) were tested on 3 different plates, 8 replicates in each plate
  • CV(%) = SD/meanX100
  • Intra-Assay: CV<10%
  • Inter-Assay:
  • Show more
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group X (PLA2G10) in serum, plasma and other biological fluids.

Human Phospholipase A2, Group X (PLA2G10) ELISA Kit

SED833Hu-5x96wellstestplate 5x96-wells test plate
EUR 2575.5
  • The Intra-assay Precision is determined when 3 samples with low, middle and high level of Human Phospholipase A2, Group X (PLA2G10) were tested on 3 different plates, 8 replicates in each plate
  • CV(%) = SD/meanX100
  • Intra-Assay: CV<10%
  • Inter-Assay:
  • Show more
Description: This is Double-antibody Sandwich Enzyme-linked immunosorbent assay for detection of Human Phospholipase A2, Group X (PLA2G10) in serum, plasma and other biological fluids.

Human Phospholipase A2, Group X (PLA2G10) ELISA Kit

4-SED833Hu
  • EUR 4782.00
  • EUR 2526.00
  • EUR 640.00
  • 10 plates of 96 wells
  • 5 plates of 96 wells
  • 1 plate of 96 wells
  • Known also as Phospholipase A2, Group X elisa. Alternative names of the recognized antigen: GXPLA2
  • GX sPLA2
  • sPLA2-X
  • Group 10 secretory phospholipase A2
  • Phosphatidylcholine 2-acylhydrolase 10
Description: Enzyme-linked immunosorbent assay based on the Double-antibody Sandwich method for detection of Human Phospholipase A2, Group X (PLA2G10) in samples from Serum, plasma and other biological fluids with no significant corss-reactivity with analogues from other species.

Phospholipase A2, Group X (PLA2G10) Antibody

20-abx126373
  • EUR 411.00
  • EUR 592.00
  • EUR 182.00
  • EUR 314.00
  • 100 ul
  • 200 ul
  • 20 ul
  • 50 ul
  • Shipped within 5-10 working days.

Phospholipase A2, Group X (PLA2G10) Antibody

20-abx128169
  • EUR 425.00
  • EUR 133.00
  • EUR 1205.00
  • EUR 578.00
  • EUR 328.00
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug
  • Shipped within 5-7 working days.

Phospholipase A2, Group X (PLA2G10) Antibody

20-abx174048
  • EUR 857.00
  • EUR 439.00
  • 1 mg
  • 200 ug
  • Please enquire.

Phospholipase A2, Group X (PLA2G10) Antibody

20-abx301835
  • EUR 411.00
  • EUR 1845.00
  • EUR 599.00
  • EUR 182.00
  • EUR 300.00
  • 100 ug
  • 1 mg
  • 200 ug
  • 20 ug
  • 50 ug
  • Shipped within 5-10 working days.

Recombinant Phospholipase A2, Group X (PLA2G10)

4-RPD833Hu01
  • EUR 501.41
  • EUR 237.00
  • EUR 1605.28
  • EUR 601.76
  • EUR 1103.52
  • EUR 398.00
  • EUR 3863.20
  • 100 ug
  • 10ug
  • 1 mg
  • 200 ug
  • 500 ug
  • 50ug
  • 5 mg
  • Uniprot ID: O15496
  • Buffer composition: PBS, pH 7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
  • Form: Freeze-dried powder
  • Predicted Molecular Mass (KD): 18.7KDa
  • Isoelectric Point: Inquire
Description: Recombinant Human Phospholipase A2, Group X expressed in: E.coli

Human Phospholipase A2, Group X (PLA2G10) Protein

20-abx167064
  • EUR 704.00
  • EUR 286.00
  • EUR 2165.00
  • EUR 829.00
  • EUR 495.00
  • 100 ug
  • 10 ug
  • 1 mg
  • 200 ug
  • 50 ug
  • Shipped within 5-7 working days.

Monkey Phospholipase A2, Group X (PLA2G10) ELISA Kit

abx360270-96tests 96 tests
EUR 825
  • Shipped within 5-12 working days.

Pig Phospholipase A2, Group X (PLA2G10) ELISA Kit

abx362012-96tests 96 tests
EUR 825
  • Shipped within 5-12 working days.

Rabbit Phospholipase A2, Group X (PLA2G10) ELISA Kit

abx362347-96tests 96 tests
EUR 825
  • Shipped within 5-12 working days.

Chicken Phospholipase A2, Group X (PLA2G10) ELISA Kit

abx356098-96tests 96 tests
EUR 825
  • Shipped within 5-12 working days.

Human Phospholipase A2, Group X (PLA2G10) CLIA Kit

abx197460-96tests 96 tests
EUR 825
  • Shipped within 5-12 working days.

Human Phospholipase A2, Group X (PLA2G10) CLIA Kit

20-abx494408
  • EUR 7973.00
  • EUR 4246.00
  • EUR 981.00
  • 10 × 96 tests
  • 5 × 96 tests
  • 96 tests
  • Please enquire.

ELISA kit for Human PLA2G10 (Phospholipase A2, Group X)

E-EL-H1011 1 plate of 96 wells
EUR 534
  • Gentaur's PLA2G10 ELISA kit utilizes the Sandwich-ELISA principle. The micro ELISA plate provided in this kit has been pre-coated with an antibody specific to Human PLA2G10. Standards or samples are added to the micro ELISA plate wells and combined w
  • Show more
Description: A sandwich ELISA kit for quantitative measurement of Human PLA2G10 (Phospholipase A2, Group X) in samples from Serum, Plasma, Cell supernatant

ELISA kit for Human PLA2G10 (Phospholipase A2, Group X)

ELK4236 1 plate of 96 wells
EUR 432
  • The microtiter plate provided in this kit has been pre-coated with an antibody specific to Phospholipase A2, Group X (PLA2G10). Standards or samples are then added to the appropriate microtiter plate wells with a biotin-conjugated antibody specific t
  • Show more
Description: A sandwich ELISA kit for detection of Phospholipase A2, Group X from Human in samples from blood, serum, plasma, cell culture fluid and other biological fluids.

Phospholipase A2, Group X (PLA2G10) Antibody (HRP)

20-abx315919
  • EUR 411.00
  • EUR 1845.00
  • EUR 599.00
  • EUR 182.00
  • EUR 300.00
  • 100 ug
  • 1 mg
  • 200 ug
  • 20 ug
  • 50 ug
  • Shipped within 5-10 working days.

Phospholipase A2, Group X (PLA2G10) Antibody (FITC)

20-abx315920
  • EUR 411.00
  • EUR 1845.00
  • EUR 599.00
  • EUR 182.00
  • EUR 300.00
  • 100 ug
  • 1 mg
  • 200 ug
  • 20 ug
  • 50 ug
  • Shipped within 5-10 working days.

Phospholipase A2, Group X (PLA2G10) Antibody (Biotin)

20-abx315921
  • EUR 411.00
  • EUR 1845.00
  • EUR 599.00
  • EUR 182.00
  • EUR 300.00
  • 100 ug
  • 1 mg
  • 200 ug
  • 20 ug
  • 50 ug
  • Shipped within 5-10 working days.

Phospholipase A2, Group X (PLA2G10) Polyclonal Antibody (Human)

4-PAD833Hu01
  • EUR 247.00
  • EUR 2510.00
  • EUR 625.00
  • EUR 310.00
  • EUR 214.00
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
  • Sequence of the immunogen: PLA2G10 (Glu32~Asp165)
  • Buffer composition: PBS, pH7.4, containing 0.02% NaN3, 50% glycerol.
Description: A Rabbit polyclonal antibody against Human Phospholipase A2, Group X (PLA2G10)

CLIA kit for Human PLA2G10 (Phospholipase A2, Group X)

E-CL-H0681 1 plate of 96 wells
EUR 584
  • Gentaur's PLA2G10 CLIA kit utilizes the Sandwich- CLIA principle. The micro CLIA plate provided in this kit has been pre-coated with an antibody specific to Human PLA2G10 . Standards or samples are added to the micro CLIA plate wells and combined wit
  • Show more
Description: A sandwich CLIA kit for quantitative measurement of Human PLA2G10 (Phospholipase A2, Group X) in samples from Serum, Plasma, Cell supernatant

Phospholipase A2, Group X (PLA2G10) Polyclonal Antibody (Human), APC

4-PAD833Hu01-APC
  • EUR 345.00
  • EUR 3275.00
  • EUR 912.00
  • EUR 440.00
  • EUR 219.00
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
  • Sequence of the immunogen: PLA2G10 (Glu32~Asp165)
  • Buffer composition: PBS, pH7.4, containing 0.02% NaN3, 50% glycerol.
Description: A Rabbit polyclonal antibody against Human Phospholipase A2, Group X (PLA2G10). This antibody is labeled with APC.

Phospholipase A2, Group X (PLA2G10) Polyclonal Antibody (Human), Biotinylated

4-PAD833Hu01-Biotin
  • EUR 311.00
  • EUR 2460.00
  • EUR 727.00
  • EUR 381.00
  • EUR 219.00
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
  • Sequence of the immunogen: PLA2G10 (Glu32~Asp165)
  • Buffer composition: PBS, pH7.4, containing 0.02% NaN3, 50% glycerol.
Description: A Rabbit polyclonal antibody against Human Phospholipase A2, Group X (PLA2G10). This antibody is labeled with Biotin.

Phospholipase A2, Group X (PLA2G10) Polyclonal Antibody (Human), Cy3

4-PAD833Hu01-Cy3
  • EUR 419.00
  • EUR 4325.00
  • EUR 1175.00
  • EUR 545.00
  • EUR 251.00
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
  • Sequence of the immunogen: PLA2G10 (Glu32~Asp165)
  • Buffer composition: PBS, pH7.4, containing 0.02% NaN3, 50% glycerol.
Description: A Rabbit polyclonal antibody against Human Phospholipase A2, Group X (PLA2G10). This antibody is labeled with Cy3.

Phospholipase A2, Group X (PLA2G10) Polyclonal Antibody (Human), FITC

4-PAD833Hu01-FITC
  • EUR 296.00
  • EUR 2640.00
  • EUR 750.00
  • EUR 372.00
  • EUR 195.00
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
  • Sequence of the immunogen: PLA2G10 (Glu32~Asp165)
  • Buffer composition: PBS, pH7.4, containing 0.02% NaN3, 50% glycerol.
Description: A Rabbit polyclonal antibody against Human Phospholipase A2, Group X (PLA2G10). This antibody is labeled with FITC.

Phospholipase A2, Group X (PLA2G10) Polyclonal Antibody (Human), HRP

4-PAD833Hu01-HRP
  • EUR 316.00
  • EUR 2855.00
  • EUR 807.00
  • EUR 398.00
  • EUR 206.00
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
  • Sequence of the immunogen: PLA2G10 (Glu32~Asp165)
  • Buffer composition: PBS, pH7.4, containing 0.02% NaN3, 50% glycerol.
Description: A Rabbit polyclonal antibody against Human Phospholipase A2, Group X (PLA2G10). This antibody is labeled with HRP.

Phospholipase A2, Group X (PLA2G10) Polyclonal Antibody (Human), PE

4-PAD833Hu01-PE
  • EUR 296.00
  • EUR 2640.00
  • EUR 750.00
  • EUR 372.00
  • EUR 195.00
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
  • Sequence of the immunogen: PLA2G10 (Glu32~Asp165)
  • Buffer composition: PBS, pH7.4, containing 0.02% NaN3, 50% glycerol.
Description: A Rabbit polyclonal antibody against Human Phospholipase A2, Group X (PLA2G10). This antibody is labeled with PE.

Phospholipase A2, Group X (PLA2G10) Polyclonal Antibody (Human), APC-Cy7

4-PAD833Hu01-APC-Cy7
  • EUR 571.00
  • EUR 6430.00
  • EUR 1705.00
  • EUR 760.00
  • EUR 319.00
  • 100ul
  • 10ml
  • 1ml
  • 200ul
  • 20ul
  • Sequence of the immunogen: PLA2G10 (Glu32~Asp165)
  • Buffer composition: PBS, pH7.4, containing 0.02% NaN3, 50% glycerol.
Description: A Rabbit polyclonal antibody against Human Phospholipase A2, Group X (PLA2G10). This antibody is labeled with APC-Cy7.

Human Group 10 secretory phospholipase A2(PLA2G10) ELISA kit

CSB-EL018085HU-24T 1 plate of 24 wells
EUR 165
  • Sample volume: 50-100ul
  • Detection wavelength: 450nm
  • Assay performance time: 1 to 4 hours.
Description: Quantitativesandwich ELISA kit for measuring Human Group 10 secretory phospholipase A2 (PLA2G10) in samples from serum, plasma, cell culture supernates, tissue homogenates. A new trial version of the kit, which allows you to test the kit in your application at a reasonable price.

Human Group 10 secretory phospholipase A2(PLA2G10) ELISA kit

1-CSB-EL018085HU
  • EUR 804.00
  • EUR 5099.00
  • EUR 2704.00
  • 1 plate of 96 wells
  • 10 plates of 96 wells each
  • 5 plates of 96 wells each
  • Sample volume: 50-100ul
  • Detection wavelength: 450nm
  • Assay performance time: 1 to 4 hours.
Description: Quantitativesandwich ELISA kit for measuring Human Group 10 secretory phospholipase A2(PLA2G10) in samples from serum, plasma, cell culture supernates, tissue homogenates. Now available in a cost efficient pack of 5 plates of 96 wells each, conveniently packed along with the other reagents in 5 separate kits.

Human Group 10 secretory phospholipase A2, PLA2G10 ELISA KIT

ELI-37033h 96 Tests
EUR 824

Mouse Group 10 secretory phospholipase A2(PLA2G10) ELISA kit

CSB-EL018085MO-24T 1 plate of 24 wells
EUR 165
  • Sample volume: 50-100ul
  • Detection wavelength: 450nm
  • Assay performance time: 1 to 4 hours.
Description: Quantitativesandwich ELISA kit for measuring Mouse Group 10 secretory phospholipase A2 (PLA2G10) in samples from serum, plasma, cell culture supernates, tissue homogenates. A new trial version of the kit, which allows you to test the kit in your application at a reasonable price.

Mouse Group 10 secretory phospholipase A2(PLA2G10) ELISA kit

1-CSB-EL018085MO
  • EUR 804.00
  • EUR 5099.00
  • EUR 2704.00
  • 1 plate of 96 wells
  • 10 plates of 96 wells each
  • 5 plates of 96 wells each
  • Sample volume: 50-100ul
  • Detection wavelength: 450nm
  • Assay performance time: 1 to 4 hours.
Description: Quantitativesandwich ELISA kit for measuring Mouse Group 10 secretory phospholipase A2(PLA2G10) in samples from serum, plasma, cell culture supernates, tissue homogenates. Now available in a cost efficient pack of 5 plates of 96 wells each, conveniently packed along with the other reagents in 5 separate kits.

Rat Group 10 secretory phospholipase A2(PLA2G10) ELISA kit

CSB-EL018085RA-24T 1 plate of 24 wells
EUR 165
  • Sample volume: 50-100ul
  • Detection wavelength: 450nm
  • Assay performance time: 1 to 4 hours.
Description: Quantitativesandwich ELISA kit for measuring Rat Group 10 secretory phospholipase A2 (PLA2G10) in samples from serum, plasma, cell culture supernates, tissue homogenates. A new trial version of the kit, which allows you to test the kit in your application at a reasonable price.

Rat Group 10 secretory phospholipase A2(PLA2G10) ELISA kit

1-CSB-EL018085RA
  • EUR 804.00
  • EUR 5099.00
  • EUR 2704.00
  • 1 plate of 96 wells
  • 10 plates of 96 wells each
  • 5 plates of 96 wells each
  • Sample volume: 50-100ul
  • Detection wavelength: 450nm
  • Assay performance time: 1 to 4 hours.
Description: Quantitativesandwich ELISA kit for measuring Rat Group 10 secretory phospholipase A2(PLA2G10) in samples from serum, plasma, cell culture supernates, tissue homogenates. Now available in a cost efficient pack of 5 plates of 96 wells each, conveniently packed along with the other reagents in 5 separate kits.

Mouse Group 10 secretory phospholipase A2, Pla2g10 ELISA KIT

ELI-16162m 96 Tests
EUR 865

PLA2G10 Secreted Phospholipase A2-X Human Recombinant Protein

PROTO15496 Regular: 10ug
EUR 317
Description: Secreted Phospholipase A2-X Human Recombinant is manufactured with N-terminal fusion HisTag. PLA2G10 His-Tagged Fusion Protein, is 15.5 kDa containing 123 amino acid residues of the human secreted phospholipase A2-X and 16 additional amino acid residues - HisTag (underlined).;MRGSHHHHHHGMASHMGILELAGTVGCVGPRTPIAYMKYGCFCGLGGHGQ;PRDAIDWCCHGHDCCYTRAEEAGCSPKTERYSWQCVNQSVLCGPAENKCQE;LLCKCDQEIANCLAQTEYNLKYLFYPQFLCEPDSPKCD.

ELISA kit for Rat Group 10 secretory phospholipase A2 (PLA2G10)

KTE100470-48T 48T
EUR 332
  • The A2 phospholipases (PLA2s
  • EC 3.1.1.4) catalyze the release of fatty acids from phospholipids and play a role in a wide range of physiologic functions. Cupillard et al. (1997) cloned a novel secretory PLA2, termed GXSPLA2, from a human fetal lung
  • Show more
Description: Quantitative sandwich ELISA for measuring Rat Group 10 secretory phospholipase A2 (PLA2G10) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

ELISA kit for Rat Group 10 secretory phospholipase A2 (PLA2G10)

KTE100470-5platesof96wells 5 plates of 96 wells
EUR 2115
  • The A2 phospholipases (PLA2s
  • EC 3.1.1.4) catalyze the release of fatty acids from phospholipids and play a role in a wide range of physiologic functions. Cupillard et al. (1997) cloned a novel secretory PLA2, termed GXSPLA2, from a human fetal lung
  • Show more
Description: Quantitative sandwich ELISA for measuring Rat Group 10 secretory phospholipase A2 (PLA2G10) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

ELISA kit for Rat Group 10 secretory phospholipase A2 (PLA2G10)

KTE100470-96T 96T
EUR 539
  • The A2 phospholipases (PLA2s
  • EC 3.1.1.4) catalyze the release of fatty acids from phospholipids and play a role in a wide range of physiologic functions. Cupillard et al. (1997) cloned a novel secretory PLA2, termed GXSPLA2, from a human fetal lung
  • Show more
Description: Quantitative sandwich ELISA for measuring Rat Group 10 secretory phospholipase A2 (PLA2G10) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

Human Phospholipase A2, Group IID (PLA2G2D)ELISA kit

201-12-2525 96 tests
EUR 440
  • This Phospholipase A2 ELISA kit is validated to work with samples from whole blood, serum, plasma and cell culture supernatant.
Description: A quantitative ELISA kit for measuring Human in samples from biological fluids.

Human Phospholipase A2, Group IIA (PLA2G2A)ELISA kit

201-12-2527 96 tests
EUR 440
  • This Phospholipase A2 ELISA kit is validated to work with samples from whole blood, serum, plasma and cell culture supernatant.
Description: A quantitative ELISA kit for measuring Human in samples from biological fluids.

Human Phospholipase A2, Group IVD (PLA2G4D)ELISA kit

201-12-2529 96 tests
EUR 440
  • This Phospholipase A2 ELISA kit is validated to work with samples from whole blood, serum, plasma and cell culture supernatant.
Description: A quantitative ELISA kit for measuring Human in samples from biological fluids.

Human Phospholipase A2, Group XIIB (PLA2G12B)ELISA kit

201-12-2530 96 tests
EUR 440
  • This Phospholipase A2 ELISA kit is validated to work with samples from whole blood, serum, plasma and cell culture supernatant.
Description: A quantitative ELISA kit for measuring Human in samples from biological fluids.

Human Phospholipase A2, Group XIIB (PLA2G12B) ELISA Kit

DLR-PLA2G12B-Hu-48T 48T
EUR 554
  • Should the Human Phospholipase A2, Group XIIB (PLA2G12B) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A sandwich quantitative ELISA assay kit for detection of Human Phospholipase A2, Group XIIB (PLA2G12B) in samples from serum, plasma, tissue homogenates or other biological fluids.

Human Phospholipase A2, Group XIIB (PLA2G12B) ELISA Kit

DLR-PLA2G12B-Hu-96T 96T
EUR 725
  • Should the Human Phospholipase A2, Group XIIB (PLA2G12B) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A sandwich quantitative ELISA assay kit for detection of Human Phospholipase A2, Group XIIB (PLA2G12B) in samples from serum, plasma, tissue homogenates or other biological fluids.

Human Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit

DLR-PLA2G2A-Hu-48T 48T
EUR 517
  • Should the Human Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A sandwich quantitative ELISA assay kit for detection of Human Phospholipase A2, Group IIA (PLA2G2A) in samples from serum, plasma, tissue homogenates or other biological fluids.

Human Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit

DLR-PLA2G2A-Hu-96T 96T
EUR 673
  • Should the Human Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A sandwich quantitative ELISA assay kit for detection of Human Phospholipase A2, Group IIA (PLA2G2A) in samples from serum, plasma, tissue homogenates or other biological fluids.

Human Phospholipase A2, Group IID (PLA2G2D) ELISA Kit

DLR-PLA2G2D-Hu-48T 48T
EUR 498
  • Should the Human Phospholipase A2, Group IID (PLA2G2D) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A sandwich quantitative ELISA assay kit for detection of Human Phospholipase A2, Group IID (PLA2G2D) in samples from serum, plasma, tissue homogenates or other biological fluids.

Human Phospholipase A2, Group IID (PLA2G2D) ELISA Kit

DLR-PLA2G2D-Hu-96T 96T
EUR 647
  • Should the Human Phospholipase A2, Group IID (PLA2G2D) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A sandwich quantitative ELISA assay kit for detection of Human Phospholipase A2, Group IID (PLA2G2D) in samples from serum, plasma, tissue homogenates or other biological fluids.

Human Phospholipase A2, Group III (PLA2G3) ELISA Kit

DLR-PLA2G3-Hu-48T 48T
EUR 517
  • Should the Human Phospholipase A2, Group III (PLA2G3) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A sandwich quantitative ELISA assay kit for detection of Human Phospholipase A2, Group III (PLA2G3) in samples from serum, plasma or other biological fluids.

Human Phospholipase A2, Group III (PLA2G3) ELISA Kit

DLR-PLA2G3-Hu-96T 96T
EUR 673
  • Should the Human Phospholipase A2, Group III (PLA2G3) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A sandwich quantitative ELISA assay kit for detection of Human Phospholipase A2, Group III (PLA2G3) in samples from serum, plasma or other biological fluids.

Human Phospholipase A2, Group IVD (PLA2G4D) ELISA Kit

DLR-PLA2G4D-Hu-48T 48T
EUR 554
  • Should the Human Phospholipase A2, Group IVD (PLA2G4D) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A sandwich quantitative ELISA assay kit for detection of Human Phospholipase A2, Group IVD (PLA2G4D) in samples from tissue homogenates or other biological fluids.

Human Phospholipase A2, Group IVD (PLA2G4D) ELISA Kit

DLR-PLA2G4D-Hu-96T 96T
EUR 725
  • Should the Human Phospholipase A2, Group IVD (PLA2G4D) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A sandwich quantitative ELISA assay kit for detection of Human Phospholipase A2, Group IVD (PLA2G4D) in samples from tissue homogenates or other biological fluids.

Human Phospholipase A2, Group V (PLA2G5) ELISA Kit

DLR-PLA2G5-Hu-48T 48T
EUR 517
  • Should the Human Phospholipase A2, Group V (PLA2G5) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A sandwich quantitative ELISA assay kit for detection of Human Phospholipase A2, Group V (PLA2G5) in samples from serum, plasma, tissue homogenates or other biological fluids.

Human Phospholipase A2, Group V (PLA2G5) ELISA Kit

DLR-PLA2G5-Hu-96T 96T
EUR 673
  • Should the Human Phospholipase A2, Group V (PLA2G5) ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A sandwich quantitative ELISA assay kit for detection of Human Phospholipase A2, Group V (PLA2G5) in samples from serum, plasma, tissue homogenates or other biological fluids.

Human Phospholipase A2, Group XIIB (PLA2G12B) ELISA Kit

20-abx152759
  • EUR 7378.00
  • EUR 3933.00
  • EUR 911.00
  • 10 × 96 tests
  • 5 × 96 tests
  • 96 tests
  • Shipped within 5-7 working days.

Human Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit

20-abx152760
  • EUR 7378.00
  • EUR 3933.00
  • EUR 911.00
  • 10 × 96 tests
  • 5 × 96 tests
  • 96 tests
  • Shipped within 5-7 working days.

Human Phospholipase A2, Group IID (PLA2G2D) ELISA Kit

20-abx152761
  • EUR 7112.00
  • EUR 3792.00
  • EUR 879.00
  • 10 × 96 tests
  • 5 × 96 tests
  • 96 tests
  • Shipped within 5-7 working days.

Human Phospholipase A2, Group IVD (PLA2G4D) ELISA Kit

20-abx152762
  • EUR 7378.00
  • EUR 3933.00
  • EUR 911.00
  • 10 × 96 tests
  • 5 × 96 tests
  • 96 tests
  • Shipped within 5-7 working days.

Human Phospholipase A2, Group V (PLA2G5) ELISA Kit

20-abx152763
  • EUR 7378.00
  • EUR 3933.00
  • EUR 911.00
  • 10 × 96 tests
  • 5 × 96 tests
  • 96 tests
  • Shipped within 5-7 working days.

Human Phospholipase A2 Group VI (PLA2G6) ELISA Kit

abx253845-96tests 96 tests
EUR 668
  • Shipped within 5-12 working days.

Human Group XV phospholipase A2, PLA2G15 ELISA KIT

ELI-21820h 96 Tests
EUR 824

Human Group XVI phospholipase A2, PLA2G16 ELISA KIT

ELI-45167h 96 Tests
EUR 824

Human Group IIA phospholipase A2 (PLA2G2A) ELISA Kit

abx575929-96tests 96 tests
EUR 739
  • Shipped within 5-12 working days.

Human Phospholipase A2, Group XIIB(PLA2G12B)ELISA Kit

QY-E05175 96T
EUR 361

Human Phospholipase A2, Group IVD(PLA2G4D)ELISA Kit

QY-E05205 96T
EUR 361

Human Phospholipase A2, Group IID(PLA2G2D)ELISA Kit

QY-E05226 96T
EUR 361

Human Phospholipase A2, Group IIA(PLA2G2A)ELISA Kit

QY-E05227 96T
EUR 361

Human Phospholipase A2, Group IIA ELISA Kit (PLA2G2A)

RK02095 96 Tests
EUR 521

Human PLA2G10(Phospholipase A2, Group X) ELISA Kit